PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g57082.1.p
Common NameBRADI_1g57082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 741aa    MW: 81829.4 Da    PI: 5.9502
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g57082.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.85.2e-1568117756
                       --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       + +eq+e+Le++F++++ p++     L+++lg+t+ qVk WFqNrRa  k
  Bradi1g57082.1.p  68 HRREQIEQLEAVFQECPFPDEILQLNLSMSLGMTQMQVKAWFQNRRAALK 117
                       5689******************************************9877 PP

2START84.32.7e-272444637205
                       HHHHHHHH..HHC-TT-EEEE..EXCCTTEEEEEEESSS..SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT.. CS
             START   7 aqelvkka..laeepgWvkss..esengdevlqkfeeskv.dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg.. 88 
                        +e++++a  +++ep+W + +  e +n++++   f +++  + ++  r +++v   + +lv++l+d +  W+++++    +++  + ++++  
  Bradi1g57082.1.p 244 SEEFMSLAvsTLGEPMWLLTVdgEVLNKQTYNVMFRPDQMgFAMDGTRKTAMVMVKADNLVRILMDPA-HWSKMFPgivaSVTSSQIVNPNas 335
                       55555555336789*******99888899888888888887899999*********************.*******99888888888999999 PP

                       ..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE......-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
             START  89 ..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd......seqkppe.sssvvRaellpSgiliepksnghskvtwvehvd 171
                         + +qlm+ael +l p vp  ++ f+R++ q +  +w++vdvSvd      se++  +    +  +++lpSg+lie++++g++k+tw+ h+ 
  Bradi1g57082.1.p 336 phELIQLMNAELRVLVPRVPlVKVKFARQCLQVQPNVWAVVDVSVDgipvdiSESNGDSfPTTYTACRMLPSGCLIEELKDGYCKITWMVHAG 428
                       99******************************************9866555566776667789****************************** PP

                       --SSXXHHHHHHHHHH.HHHHHHHHHHHHTXXXXX CS
             START 172 lkgrlphwllrslvks.glaegaktwvatlqrqce 205
                       ++ + +++l  sl+ + g+a ga +w+  l+rqce
  Bradi1g57082.1.p 429 YDMSKIPQLHLSLLDTgGQALGACRWLNSLKRQCE 463
                       **99988888887765279***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.13E-1551119IPR009057Homeodomain-like
PROSITE profilePS5007114.26859119IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.7E-1560126IPR009057Homeodomain-like
SMARTSM003891.1E-1361123IPR001356Homeobox domain
CDDcd000861.97E-1466120No hitNo description
PfamPF000461.8E-1268117IPR001356Homeobox domain
SMARTSM002340.0033238464IPR002913START domain
SuperFamilySSF559611.47E-16242463No hitNo description
PfamPF018523.7E-21244463IPR002913START domain
PROSITE profilePS5084824.138257467IPR002913START domain
SuperFamilySSF559614.31E-6551680No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 741 aa     Download sequence    Send to blast
MDDGEGQQHN CDFLDFEQLL KFGTLGYDQM DGMSSVEPNY TNIDGVDAAA PGQNNNGMIN  60
QTRVSKRHRR EQIEQLEAVF QECPFPDEIL QLNLSMSLGM TQMQVKAWFQ NRRAALKNKM  120
MQRESEFLRE EKEMLEDQKR KINAVIHGKD KRCLRCRGWG PKAYNGDTPE KRRLLAENAK  180
LKEELLQAFS LLNVVSGGRA RAGTPIPKPF SPYGGQLKSQ CATSGGDSGS SPTMLLDHVL  240
SRASEEFMSL AVSTLGEPMW LLTVDGEVLN KQTYNVMFRP DQMGFAMDGT RKTAMVMVKA  300
DNLVRILMDP AHWSKMFPGI VASVTSSQIV NPNASPHELI QLMNAELRVL VPRVPLVKVK  360
FARQCLQVQP NVWAVVDVSV DGIPVDISES NGDSFPTTYT ACRMLPSGCL IEELKDGYCK  420
ITWMVHAGYD MSKIPQLHLS LLDTGGQALG ACRWLNSLKR QCEYLAFLHS DPHPLTNPVA  480
AMLPEVRKSV LESSQQMKMN FYKAMCDSAG RSWSTVDEWA GDCGVGAEKL HLAVRFVTSL  540
AAIYNGDIQT GTQLILSAMT TVWLPGIPAE RVFNYLYDGN RRWEWDSLVA NGEPMQEEVR  600
ITTGQFYGNH VSIFRAIASD GTNNNNKLIL QEAYTDTSCM LVVYVPVDEQ SMKDASMNGG  660
GCASFSTPPS GFAVIPDGLN QQTSPWSSSG AIVSAMYQIL PSSASPQNLT LDTVNNISSL  720
LYHAVNKIKS AVQAEVVVPA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3HE870.0A0A0Q3HE87_BRADI; Uncharacterized protein
STRINGBRADI2G31600.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83241742
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.16e-92HD-ZIP family protein